PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zjn_sc00008.1.g01280.1.am.mkhc
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family G2-like
Protein Properties Length: 414aa    MW: 44872.9 Da    PI: 6.1964
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zjn_sc00008.1.g01280.1.am.mkhcgenomeZGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like91.66.8e-29268321154
                         G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYR 54 
                                     k rlrWt eLHerFveav++L G+ekAtPk +l+lmkv+gLt++hvkSHLQ  R
  Zjn_sc00008.1.g01280.1.am.mkhc 268 KSRLRWTLELHERFVEAVNKLDGPEKATPKGVLKLMKVEGLTIYHVKSHLQVQR 321
                                     68*************************************************877 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.165265325IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.4E-26266321IPR009057Homeodomain-like
SuperFamilySSF466891.97E-14266322IPR009057Homeodomain-like
TIGRFAMsTIGR015571.8E-22268322IPR006447Myb domain, plants
PfamPF002498.8E-7270319IPR001005SANT/Myb domain
PfamPF143798.9E-9316344IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 414 aa     Download sequence    Send to blast
MSSRSALAVE QITAPDKTVH ASTATPPLLH KLFDAKLDHQ VLVDDTLSST SQSSNIKTEL  60
MRSSSFSKSL TLNLQKGSPE PDPESPLSHV SHPNFSDPIP SNSSTFCTTL FSSSLANPER  120
SRRIGTLPFL PHPPKCEQQV SAGQSLSSSL LLSRDIGNSL DDTEHSNDLK VLLNLSGDGS  180
DGSYHEENNA LAFAEHMEFQ FLSEQLGIAI TDNEESPRLD DIYDTPPPQL SALPVSSCSN  240
QSIQNPGSPV KVQLNSSRSS SGSVATNKSR LRWTLELHER FVEAVNKLDG PEKATPKGVL  300
KLMKVEGLTI YHVKSHLQVQ RQLQLRIEEH AKYLQKLLEE QQKTGNTSPP KTLSKTQAES  360
PESVSKESGE SEAGNSSPPS SKKRVPDVDM ESNLLAGSKR TKVQVGSGSE GSCS
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00354DAPTransfer from AT3G13040Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004966348.11e-176PREDICTED: uncharacterized protein LOC101786720
TrEMBLK3XWP61e-176K3XWP6_SETIT; Uncharacterized protein
STRINGSi006354m1e-176(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP45263769
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13040.25e-59G2-like family protein